Recombinant Mouse Pulmonary surfactant-associated protein C (Sftpc) | CSB-EP021174MO

Recombinant Mouse Pulmonary surfactant-associated protein C (Sftpc) | CSB-EP021174MO | Cusabio

Alternative Name(s): Pulmonary surfactant-associated proteolipid SPL(Val) (SP5) (SP-C) (Sftp2)

Gene Names: Sftpc

Research Areas: Cancer

Organism: Mus musculus(Mouse)

AA Sequence: FRIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGL

Source: E.coli

Tag Info: N-terminal 6xHis-KSI-tagged

Expression Region: 24-58aa

Sequence Info: Full Length of Mature Protein

MW: 19.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Reference: "Expression of a human surfactant protein C mutation associated with interstitial lung disease disrupts lung development in transgenic mice." Bridges J.P., Wert S.E., Nogee L.M., Weaver T.E. J. Biol. Chem. 278:52739-52746(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21841

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A