Cusabio Mouse Recombinants
Recombinant Mouse Proto-oncogene Wnt-1 (Wnt1) | CSB-EP026128MO
- SKU:
- CSB-EP026128MO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse Proto-oncogene Wnt-1 (Wnt1) | CSB-EP026128MO | Cusabio
Alternative Name(s): Proto-oncogene Int-1
Gene Names: Wnt1
Research Areas: Stem Cells
Organism: Mus musculus (Mouse)
AA Sequence: ANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 28-370aa
Sequence Info: Full Length of Mature Protein
MW: 45.8 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Ligand for members of the frizzled family of seven transmembrane receptors. Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation (By similarity). In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling (PubMed:15454084, PubMed:16116452). Plays an essential role in the development of the embryonic brain and central nervous system (CNS) (PubMed:2202907, PubMed:16116452). Has a role in osteoblast function, bone development and bone homeostasis (By similarity).
Reference: "Expression of multiple novel Wnt-1/int-1-related genes during fetal and adult mouse development." Gavin B.J., McMahon J.A., McMahon A.P. Genes Dev. 4:2319-2332(1990)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P04426
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A