Recombinant Mouse Protein-lysine 6-oxidase (Lox) | CSB-BP013038MO

(No reviews yet) Write a Review
SKU:
CSB-BP013038MO
Availability:
3 - 7 Working Days
€306.00 - €924.00

Description

Recombinant Mouse Protein-lysine 6-oxidase (Lox) | CSB-BP013038MO | Cusabio

Alternative Name(s): Lysyl oxidase (Ras excision protein) (Rrg)

Gene Names: Lox

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: DDPYNPYKYSDDNPYYNYYDTYERPRPGSRNRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Source: Baculovirus

Tag Info: C-terminal 6xHis-Myc-tagged

Expression Region: 163-411aa

Sequence Info: Full Length of Mature Protein

MW: 32.4

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture

Reference: "Loss of function mutation in LOX causes thoracic aortic aneurysm and dissection in humans." Brigham Genomic Medicine Lee V.S., Halabi C.M., Hoffman E.P., Carmichael N., Leshchiner I., Lian C.G., Bierhals A.J., Vuzman D., Mecham R.P., Frank N.Y., Stitziel N.O. Proc. Natl. Acad. Sci. U.S.A. 113:8759-8764(2016)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P28301

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose