Recombinant Mouse Protein atonal homolog 1 (Atoh1) | CSB-EP002306MO

(No reviews yet) Write a Review
SKU:
CSB-EP002306MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Protein atonal homolog 1 (Atoh1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse Protein atonal homolog 1 (Atoh1) | CSB-EP002306MO | Cusabio

Alternative Name(s): Helix-loop-helix protein mATH-1 Ath1

Gene Names: Atoh1

Research Areas: Epigenetics and Nuclear Signaling

Organism: Mus musculus (Mouse)

AA Sequence: MSRLLHAEEWAEVKELGDHHRHPQPHHVPPLTPQPPATLQARDLPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSPELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPNVGEQPPPPTASCKNDHHHLRTASSYEGGAGASAVAGAQPAPGGGPRPTPPGPCRTRFSGPASSGGYSVQLDALHFPAFEDRALTAMMAQKDLSPSLPGGILQPVQEDNSKTSPRSHRSDGEFSPHSHYSDSDEAS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-351aa

Sequence Info: Full Length

MW: 41.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.

Reference: "A mammalian helix-loop-helix factor structurally related to the product of Drosophila proneural gene atonal is a positive transcriptional regulator expressed in the developing nervous system." Akazawa C., Ishibashi M., Shimizu C., Nakanishi S., Kageyama R. J. Biol. Chem. 270:8730-8738(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.

Involvement in disease:

Subcellular Location: Nucleus

Protein Families:

Tissue Specificity: Developing nervous system, and in adult epithelial cells of the gastrointestinal tract.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P48985

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose