Recombinant Mouse Prion-like protein doppel (Prnd) | CSB-BP886153MO

Recombinant Mouse Prion-like protein doppel (Prnd) | CSB-BP886153MO | Cusabio

Alternative Name(s): Prnd; Prion-like protein doppel; Doppelganger; Dpl; PrPLP

Gene Names: Prnd

Research Areas: Neuroscience

Organism: Mus musculus (Mouse)

AA Sequence: RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERG

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 27-155aa

Sequence Info: Full Length of Mature Protein

MW: 18.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Doppelganger PrPLP

Reference: "Doppel is an N-glycosylated, glycosylphosphatidylinositol-anchored protein: expression in testis and ectopic production in the brains of Prnp(0/0) mice predisposed to Purkinje cell loss." Silverman G.L., Qin K., Moore R.C., Yang Y., Mastrangelo P., Tremblay P., Prusiner S.B., Cohen F.E., Westaway D. J. Biol. Chem. 275:26834-26841(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Required for normal acrosome reaction and for normal male fertility

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families: Prion family

Tissue Specificity: Detected in testis (PubMed:10842180, PubMed:12110578, PubMed:15161660). Detected within seminiferous tubules, on round and elongated spermatids (at protein level) (PubMed:12110578). Not detected in brain (at protein level) (PubMed:10842180, PubMed:15161660). Detected in testis, and at low levels in heart (PubMed:10525406, PubMed:12110578). Expression in brain is very low and barely detectable (PubMed:10525406).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9QUG3

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A