Recombinant Mouse Phospholipase A-2-activating protein (Plaa), partial | CSB-BP018107MO

Recombinant Mouse Phospholipase A-2-activating protein (Plaa), partial | CSB-BP018107MO | Cusabio

Alternative Name(s): PLA2P (PLAP) (Plap)

Gene Names: Plaa

Research Areas: Immunology

Organism: Mus musculus (Mouse)

AA Sequence: TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 495-584aa

Sequence Info: Partial

MW: 13.6

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Plays a role in protein ubiquitination, sorting and degradation through its association with VCP. Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling. May play a role in macroautophagy, regulating for instance the clearance of damaged lysosomes. Plays a role in cerebellar Purkinje cell development (PubMed:28413018). Positively regulates cytosolic and calcium-independent phospholipase A2 activities in a tumor necrosis factor alpha- or lipopolysaccharide-dependent manner, and hence prostaglandin E2 biosynthesis.

Reference: "Cloning of a rat cDNA encoding a protein with high homology to mouse phospholipase A2-activating protein." Wang H., Lemasters J.J., Herman B. Gene 161:237-241(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P27612

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A