Recombinant Mouse Phorbol-12-myristate-13-acetate-induced protein 1 (Pmaip1) | CSB-EP018229MO

(No reviews yet) Write a Review
SKU:
CSB-EP018229MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Phorbol-12-myristate-13-acetate-induced protein 1 (Pmaip1)
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP018229MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pmaip1.
£281.60 - £1,361.60

Description

Recombinant Mouse Phorbol-12-myristate-13-acetate-induced protein 1 (Pmaip1) | CSB-EP018229MO | Cusabio

Alternative Name(s): Protein Noxa (Noxa)

Gene Names: Pmaip1

Research Areas: Cancer

Organism: Mus musculus (Mouse)

AA Sequence: MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-103aa

Sequence Info: Full Length

MW: 15.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1. Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1.

Reference: "Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins." Willis S.N., Chen L., Dewson G., Wei A., Naik E., Fletcher J.I., Adams J.M., Huang D.C.S. Genes Dev. 19:1294-1305(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9JM54

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose