Recombinant Mouse Pericentrin (Pcnt), partial | CSB-EP017627MO

(No reviews yet) Write a Review
SKU:
CSB-EP017627MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Pericentrin (Pcnt), partial
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP017627MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pcnt.
$422.40 - $2,042.40

Description

Recombinant Mouse Pericentrin (Pcnt), partial | CSB-EP017627MO | Cusabio

Alternative Name(s): Pcnt2

Gene Names: Pcnt

Research Areas: Tags & Cell Markers

Organism: Mus musculus (Mouse)

AA Sequence: LCAAGLLTSFTNHTVDRTIKDWTSSNEKAVSSLMRTLEELKSELSMPTSFQKKMTAELQVQLMNELLSDNDALTKAVGMATREKAELCRTVSRLEKTLKHHTQKGCVLNRQSKSSLKQDGTDLQSSLRHSDPEWHSQTTSGDTNTCNIKMEKLYLHYLRAESFRKALIYQKKYLLLLIGGFQDSEQETLSMIAHLGVFPSKADKKITMSRPFTKFRTAVRVVIAVLRLRFLVKKWQEVDRKGALVHPKSTRHGHRTSQRQRSPSGP

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 2545-2810aa

Sequence Info: Partial

MW: 37.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Integral component of the filamentous matrix of the centrosome involved in the initial establishment of organized microtubule arrays in both mitosis and meiosis. Plays a role, together with DISC1, in the microtubule network formation. Is an integral component of the pericentriolar material. May play an important role in preventing premature centrosome splitting during interphase by inhibiting NEK2 kinase activity at the centrosome.

Reference: "LIS1 regulates CNS lamination by interacting with mNudE, a central component of the centrosome." Feng Y., Olson E.C., Stukenberg P.T., Flanagan L.A., Kirschner M.W., Walsh C.A. Neuron 28:665-679(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P48725

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose