Recombinant Mouse Oncomodulin (Ocm) | CSB-YP016264MO

Recombinant Mouse Oncomodulin (Ocm) | CSB-YP016264MO | Cusabio

Alternative Name(s): Parvalbumin beta

Gene Names: Ocm

Research Areas: Neuroscience

Organism: Mus musculus (Mouse)

AA Sequence: SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-109aa

Sequence Info: Full Length of Mature Protein

MW: 14.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.

Reference: "The intracisternal A particle derived solo LTR promoter of the rat oncomodulin gene is not present in the mouse gene."Banville D., Rotaru M., Boie Y.Genetica 86:85-97(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.

Involvement in disease:

Subcellular Location:

Protein Families: Parvalbumin family

Tissue Specificity: Found in tumor tissues and not detected in normal tissues.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P51879

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A