null

Recombinant Mouse NAD (P) H dehydrogenase [quinone] 1 (Nqo1) | CSB-YP717562MO

(No reviews yet) Write a Review
SKU:
CSB-YP717562MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse NAD (P) H dehydrogenase [quinone] 1 (Nqo1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€339.00 - €1,345.00
Frequently bought together:

Description

Recombinant Mouse NAD (P) H dehydrogenase [quinone] 1 (Nqo1) | CSB-YP717562MO | Cusabio

Alternative Name(s): Azoreductase DT-diaphorase Short name: DTD Menadione reductase NAD(P)H:quinone oxidoreductase 1 Phylloquinone reductase Quinone reductase 1 Short name: QR1

Gene Names: Nqo1

Research Areas: Metabolism

Organism: Mus musculus (Mouse)

AA Sequence: AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-274aa

Sequence Info: Full Length of Mature Protein

MW: 32.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.

Reference: "Mouse liver NAD(P)H:quinone acceptor oxidoreductase: protein sequence analysis by tandem mass spectrometry, cDNA cloning, expression in Escherichia coli, and enzyme activity analysis."Chen S., Clarke P.E., Martino P.A., Deng P.S., Yeh C.H., Lee T.D., Prochaska H.J., Talalay P.Protein Sci. 3:1296-1304(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: NAD(P)H dehydrogenase (quinone) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q64669

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose