Recombinant Mouse Myoglobin (Mb) | CSB-MP013529MO

(No reviews yet) Write a Review
SKU:
CSB-MP013529MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Myoglobin (Mb)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£423.20 - £1,040.80

Description

Recombinant Mouse Myoglobin (Mb) | CSB-MP013529MO | Cusabio

Alternative Name(s): Mb; Myoglobin

Gene Names: Mb

Research Areas: Cancer

Organism: Mus musculus (Mouse)

AA Sequence: GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 2-154aa

Sequence Info: Full Length of Mature Protein

MW: 21.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.

Reference: "The mouse myoglobin gene. Characterisation and sequence comparison with other mammalian myoglobin genes." Blanchetot A., Price M., Jeffreys A.J. Eur. J. Biochem. 159:469-474(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.

Involvement in disease:

Subcellular Location:

Protein Families: Globin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04247

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose