Recombinant Mouse Muellerian-inhibiting factor (Amh), partial | CSB-EP001666MO

(No reviews yet) Write a Review
SKU:
CSB-EP001666MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Muellerian-inhibiting factor (Amh), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€374.00 - €1,548.00

Description

Recombinant Mouse Muellerian-inhibiting factor (Amh), partial | CSB-EP001666MO | Cusabio

Alternative Name(s): Anti-Muellerian hormone

Gene Names: Amh

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Source: E.coli

Tag Info: Tag-Free

Expression Region: 450-552aa

Sequence Info: Partial

MW: 11.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.

Reference: "The genes for a spliceosome protein (SAP62) and the anti-Mullerian hormone (AMH) are contiguous." Dresser D.W., Hacker A., Lovell-Badge R., Guerrier D. Hum. Mol. Genet. 4:1613-1618(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: TGF-beta family

Tissue Specificity: Sertoli cells of fetal testes, and testes just after birth, but absent in adult testes. In female, AMH is expressed after birth in the granulosa cells of the follicle. AMH expression is dependent on the degree of follicular maturation and not on the age of the ovary.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P27106

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose