Recombinant Mouse Methyltransferase-like protein 10 (Mettl10) | CSB-YP880522MO

(No reviews yet) Write a Review
SKU:
CSB-YP880522MO
Availability:
25 - 35 Working Days
  • Recombinant Mouse Methyltransferase-like protein 10 (Mettl10)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£306.40 - £1,618.40

Description

Recombinant Mouse Methyltransferase-like protein 10 (Mettl10) | CSB-YP880522MO | Cusabio

Alternative Name(s): Methyltransferase-like protein 10;Protein-lysine N-methyltransferase Mettl10

Gene Names: Eef1akmt2

Research Areas: others

Organism: Mus musculus (Mouse)

AA Sequence: MNADAEGHSGAVVPAQSPEGSSAADDFVPSALGTREHWDAVYERELRTFQEYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELVKHGFSNITGIDYSPSAIKLSASILEKEGLSNINLKVEDFLNPSTKLSGFHVCVDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELLDAFSEGFELFEELPTPKFSFGGRSGNTVAALVFQKRGTSLDKIS

Source: Yeast

Tag Info: C-terminal 6xHis-Myc-tagged

Expression Region: 1-244aa

Sequence Info: Full Length

MW: 30.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-318'.

Reference: "Head bobber: an insertional mutation causes inner ear defects, hyperactive circling, and deafness." Somma G., Alger H.M., McGuire R.M., Kretlow J.D., Ruiz F.R., Yatsenko S.A., Stankiewicz P., Harrison W., Funk E., Bergamaschi A., Oghalai J.S., Mikos A.G., Overbeek P.A., Pereira F.A. J Assoc Res Otolaryngol 13:335-349(2012)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9D853

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose