Recombinant Mouse Methylcytosine dioxygenase TET2 (Tet2), partial | CSB-EP678395MO

(No reviews yet) Write a Review
SKU:
CSB-EP678395MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Methylcytosine dioxygenase TET2 (Tet2), partial
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP678395MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Tet2.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP678395MO could indicate that this peptide derived from E.coli-expressed
$422.40 - $2,042.40

Description

Recombinant Mouse Methylcytosine dioxygenase TET2 (Tet2), partial | CSB-EP678395MO | Cusabio

Alternative Name(s): Protein Ayu17-449 (Kiaa1546)

Gene Names: Tet2

Research Areas: Epigenetics and Nuclear Signaling

Organism: Mus musculus (Mouse)

AA Sequence: RISLVLYRHKNLFLPKHCLALWEAKMAEKARKEEECGKNGSDHVSQKNHGKQEKREPTGPQEPSYLRFIQSLAENTGSVTTDSTVTTSPYAFTQVTGPYNTFV

Source: E.coli

Tag Info: N-terminal 6xHis-KSI-tagged

Expression Region: 1810-1912aa

Sequence Info: Partial

MW: 27.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine into 5-hydroxymethylcytosine and plays a key role in active DNA demethylation. Has a preference for 5-hydroxymethylcytosine in CpG motifs. Also mediates subsequent conversion of 5hmC into 5-formylcytosine, and conversion of 5fC to 5-carboxylcytosine. Conversion of 5mC into 5hmC, 5fC and 5caC probably constitutes the first step in cytosine demethylation. Methylation at the C5 position of cytosine bases is an epigenetic modification of the mammalian genome which plays an important role in transcriptional regulation. In addition to its role in DNA demethylation, also involved in the recruitment of the O-GlcNAc transferase OGT to CpG-rich transcription start sites of active genes, thereby promoting histone H2B GlcNAcylation by OGT.

Reference: "Combined deficiency of tet1 and tet2 causes epigenetic abnormalities but is compatible with postnatal development." Dawlaty M.M., Breiling A., Le T., Raddatz G., Barrasa M.I., Cheng A.W., Gao Q., Powell B.E., Li Z., Xu M., Faull K.F., Lyko F., Jaenisch R. Dev. Cell 24:310-323(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC) and plays a key role in active DNA demethylation. Has a preference for 5-hydroxymethylcytosine in CpG motifs. Also mediates subsequent conversion of 5hmC into 5-formylcytosine (5fC), and conversion of 5fC to 5-carboxylcytosine (5caC). Conversion of 5mC into 5hmC, 5fC and 5caC probably constitutes the first step in cytosine demethylation. Methylation at the C5 position of cytosine bases is an epigenetic modification of the mammalian genome which plays an important role in transcriptional regulation. In addition to its role in DNA demethylation, also involved in the recruitment of the O-GlcNAc transferase OGT to CpG-rich transcription start sites of active genes, thereby promoting histone H2B GlcNAcylation by OGT.

Involvement in disease:

Subcellular Location:

Protein Families: TET family

Tissue Specificity: Highly expressed in the brain, kidney, heart, lung, muscle and stomach. Present in embryonic stem cells (ES cells).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q4JK59

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose