Cusabio Mouse Recombinants
Recombinant Mouse Metallothionein-3 (Mt3) | CSB-YP015122MO
- SKU:
- CSB-YP015122MO
- Availability:
- 25 - 35 Working Days
Description
Recombinant Mouse Metallothionein-3 (Mt3) | CSB-YP015122MO | Cusabio
Alternative Name(s): Metallothionein-3(MT-3)(Growth inhibitory factor)(GIF)(Metallothionein-III)(MT-III)
Gene Names: Mt3
Research Areas: Neuroscience
Organism: Mus musculus (Mouse)
AA Sequence: MDPETCPCPTGGSCTCSDKCKCKGCKCTNCKKSCCSCCPAGCEKCAKDCVCKGEEGAKAEAEKCSCCQ
Source: Yeast
Tag Info: N-terminal 10xHis-tagged
Expression Region: 1-68aa
Sequence Info: Full Length
MW: 9.5 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro (By similarity).
Reference: "Three-dimensional structure and dynamics of a brain specific growth inhibitory factor: metallothionein-3." Oz G., Zangger K., Armitage I.M. Biochemistry 40:11433-11441(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P28184
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A