Recombinant Mouse Major urinary proteins 11 and 8 (Mup11) | CSB-EP361419MO

(No reviews yet) Write a Review
SKU:
CSB-EP361419MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Major urinary proteins 11 and 8 (Mup11)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse Major urinary proteins 11 and 8 (Mup11) | CSB-EP361419MO | Cusabio

Alternative Name(s): MUP11 and MUP8

Gene Names: Mup11

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-151aa

Sequence Info: Full Length

MW: 21.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.

Reference: Analysis of mouse major urinary protein genes variation between the exonic sequences of group 1 genes and a comparison with an active gene out with group 1 both suggest that gene conversion has occurred between MUP genes.Clark A.J., Chave-Cox A., Ma X., Bishop J.O.EMBO J. 4:3167-3171(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Major urinary proteins (Mups) bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance (Probable). Binds the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT) in vitro

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Calycin superfamily, Lipocalin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04938

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose