Cusabio Mouse Recombinants
Recombinant Mouse Major urinary proteins 11 and 8 (Mup11) | CSB-EP361419MO
- SKU:
- CSB-EP361419MO
- Availability:
- 13 - 23 Working Days
Description
Recombinant Mouse Major urinary proteins 11 and 8 (Mup11) | CSB-EP361419MO | Cusabio
Alternative Name(s): MUP11 and MUP8
Gene Names: Mup11
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-151aa
Sequence Info: Full Length
MW: 21.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.
Reference: Analysis of mouse major urinary protein genes variation between the exonic sequences of group 1 genes and a comparison with an active gene out with group 1 both suggest that gene conversion has occurred between MUP genes.Clark A.J., Chave-Cox A., Ma X., Bishop J.O.EMBO J. 4:3167-3171(1985)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Major urinary proteins (Mups) bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance (Probable). Binds the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT) in vitro
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Calycin superfamily, Lipocalin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P04938
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A