Recombinant Mouse Major urinary protein 6 (Mup6) | CSB-EP360881MO

Recombinant Mouse Major urinary protein 6 (Mup6) | CSB-EP360881MO | Cusabio

Alternative Name(s): Alpha-2U-globulin Group 1, BS6 Allergen: Mus m 1

Gene Names: Mup6

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 19-180aa

Sequence Info: Full Length of Mature Protein

MW: 34.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.

Reference: "Sequence structures of a mouse major urinary protein gene and pseudogene compared."Clark A.J., Ghazal P., Bingham R.W., Barrett D., Bishop J.O.EMBO J. 4:3159-3165(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Calycin superfamily, Lipocalin family

Tissue Specificity: Abundant in the urine of adult male mice but absent from that of females.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02762

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A