Recombinant Mouse Major urinary protein 11 (Mup11) | CSB-EP361419MOb0

Recombinant Mouse Major urinary protein 11 (Mup11) | CSB-EP361419MOb0 | Cusabio

Alternative Name(s): Mup9

Gene Names: Mup11

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-151aa

Sequence Info: Full Length

MW: 23.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Major urinary proteins bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance. Binds the pheromone analog 2-sec-butyl-4,5-dihydrothiazole in vitro .

Reference: "Modulation of Aire regulates the expression of tissue-restricted antigens." Kont V., Laan M., Kisand K., Merits A., Scott H.S., Peterson P. Mol. Immunol. 45:25-33(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04938

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A