Recombinant Mouse Lymphocyte antigen 6K (Ly6k) | CSB-YP861475MO

Recombinant Mouse Lymphocyte antigen 6K (Ly6k) | CSB-YP861475MO | Cusabio

Alternative Name(s): Ly-6K

Gene Names: Ly6k

Research Areas: Immunology

Organism: Mus musculus (Mouse)

AA Sequence: LTCHVCEAQNSYACSNPSQCPGEKKFCLLAVTRIFERFFYVSKQCTRRCPTPVVSPPSTNPPSEPKEFLIEKPMPFLFYKCCQWDSCNGEGPPTDQLLKEQPG

Source: Yeast

Tag Info: C-terminal 6xHis-tagged

Expression Region: 21-123aa

Sequence Info: Full Length of Mature Protein

MW: 13.1

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida . May play a role in cell growth .

Reference: "TEX101, a germ cell-marker glycoprotein, is associated with lymphocyte antigen 6 complex locus k within the mouse testis." Yoshitake H., Tsukamoto H., Maruyama-Fukushima M., Takamori K., Ogawa H., Araki Y. Biochem. Biophys. Res. Commun. 372:277-282(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9CWP4

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A