Recombinant Mouse Lymphocyte antigen 6G (Ly6g), partial | CSB-YP333994MO

(No reviews yet) Write a Review
SKU:
CSB-YP333994MO
Availability:
25 - 35 Working Days
  • Recombinant Mouse Lymphocyte antigen 6G (Ly6g), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$406.80 - $1,614.00

Description

Recombinant Mouse Lymphocyte antigen 6G (Ly6g), partial | CSB-YP333994MO | Cusabio

Alternative Name(s): Ly-6G.1

Gene Names: Ly6g

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 27-119aa

Sequence Info: Partial

MW: 11.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "The monoclonal antibody TER-119 recognizes a molecule associated with glycophorin A and specifically marks the late stages of murine erythroid lineage." Kina T., Ikuta K., Takayama E., Wada K., Majumdar A.S., Weissman I.L., Katsura Y. Br. J. Haematol. 109:280-287(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families:

Tissue Specificity: Expressed in bone marrow.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P35461

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose