Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III (Fcgr3), partial | CSB-MP357412MO

Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III (Fcgr3), partial | CSB-MP357412MO | Cusabio

Alternative Name(s): Fc-gamma RIII Short name: FcRIII CD_antigen: CD16

Gene Names: Fcgr3

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 31-215aa

Sequence Info: Extracellular Domain

MW: 25.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor.

Reference: "SH2-containing inositol phosphatase (SHIP-1) transiently translocates to raft domains and modulates CD16-mediated cytotoxicity in human NK cells."Galandrini R., Tassi I., Mattia G., Lenti L., Piccoli M., Frati L., Santoni A.Blood 100:4581-4589(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor which binds to IgG1, IgG2a and IgG2b

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P08508

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A