Cusabio Mouse Recombinants
Recombinant Mouse Lithostathine-1 (Reg1) | CSB-EP337329MO
- SKU:
- CSB-EP337329MO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse Lithostathine-1 (Reg1) | CSB-EP337329MO | Cusabio
Alternative Name(s): Islet of Langerhans regenerating protein 1 Short name:REG 1 Pancreatic stone protein 1 Short name:PSP Pancreatic thread protein 1 Short name:PTP Regenerating protein 1
Gene Names: Reg1
Research Areas: Cell Biology
Organism: Mus musculus (Mouse)
AA Sequence: QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 22-165aa
Sequence Info: Full Length of Mature Protein
MW: 32.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Might act as an inhibitor of spontaneous calcium carbonate precipitation.
Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Might act as an inhibitor of spontaneous calcium carbonate precipitation.
Involvement in disease:
Subcellular Location: Secreted
Protein Families:
Tissue Specificity: Expressed only in regenerating islets and normal exocrine pancreas, but not in normal pancreatic islets. Expressed strongly in pancreas, moderately in gall bladder, and weakly in liver.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P43137
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A