Recombinant Mouse Leukocyte surface antigen CD47 (Cd47), partial (Active) | CSB-AP005351MO

Recombinant Mouse Leukocyte surface antigen CD47 (Cd47) ,partial (Active) | CSB-AP005351MO | Cusabio

Protein Description: Partial of Isoform 2

Alternative Name (s) : Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6

Gene Names: Cd47

Research Areas: Cancer

Species: Mus musculus (Mouse)

Source: Mammalian cell

Tag Info: C-terminal 6xHis-tagged

Expression Region: 19-158aa

Sequence Info: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSP

Biological Activity: The ED50 as determined by its ability to bind Mouse SIRPA in functional ELISA is less than 20 ug/ml.

MW: 16.7 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: CD47, also known as Integrin‑Associated Protein (IAP) and OA3, is a glycosylated atypical member of the immunoglobulin superfamily. Mouse CD47 is an integral membrane protein that consists of a extracellular domain (ECD) with a single Ig‑like domain, five membrane-spanning regions with short intervening loops, and C‑terminal cytoplasmic tail. CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. It plays an important role in memory formation and synaptic plasticity in the hippocampus. As a receptor for SIRPA, it binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cellcell adhesion, it enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. It may play a role in membrane transport and/or integrin dependent signal transduction. It also prevents premature elimination of red blood cells.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q61735-2

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A