Cusabio Mouse Recombinants
Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3), partial | CSB-YP012941MO
- SKU:
- CSB-YP012941MO
- Availability:
- 25 - 35 Working Days
Description
Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3), partial | CSB-YP012941MO | Cusabio
Alternative Name(s): Cell-surface glycoprotein p91;Paired immunoglobulin-like receptor B ;PIR-B
Gene Names: Lilrb3
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: RRRHRGKFRKDVQKEKDLQLSSGAEEPITRKGELQKRPNPAAATQEESLYASVEDMQTEDGVELNSWTPPEEDPQGETYAQVKPSRLRKAGHVSPSVMSREQLNTEYEQAEEGQGANNQAAESGESQDVTYAQLCSRTLRQGAAASPLSQAGEAPEEPSVYATLAAARPEAVPKDMEQ
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 664-841aa
Sequence Info: Cytoplasmic Domain
MW: 21.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM).
Reference: Molecular cloning of a novel murine cell-surface glycoprotein homologous to killer cell inhibitory receptors.Hayami K., Fukuta D., Nishikawa Y., Yamashita Y., Inui M., Ohyama Y., Hikida M., Ohmori H., Takai T.J. Biol. Chem. 272:7320-7327(1997)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM).
Involvement in disease:
Subcellular Location: Cell membrane, Single-pass type I membrane protein
Protein Families:
Tissue Specificity: Detected in macrophages, splenocytes and B lymphocytes (at protein level). Detected in macrophages, mast cells, splenocytes, peritoneal cells and natural killer cells.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P97484
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A