Recombinant Mouse Leukocyte cell-derived chemotaxin-2 (Lect2) | CSB-YP012855MO

Recombinant Mouse Leukocyte cell-derived chemotaxin-2 (Lect2) | CSB-YP012855MO | Cusabio

Alternative Name(s): LECT-2;Chondromodulin II;ChM-II

Gene Names: Lect2

Research Areas: Developmental Biology

Organism: Mus musculus (Mouse)

AA Sequence: GPWANICASKSSNEIRTCDSYGCGQYSAQRTQRHHPGVDVLCSDGSVVYAPFTGKIVGQEKPYRNKNAINDGIRLSGRGFCVKIFYIKPIKYKGSIKKGEKLGTLLPLQKIYPGIQSHVHVENCDSSDPTAYL

Source: Yeast

Tag Info: C-terminal 6xHis-Myc-tagged

Expression Region: 19-151aa

Sequence Info: Full Length of Mature Protein

MW: 18.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has a neutrophil chemotactic activity. Also a positive regulator of chondrocyte proliferation.

Reference: "Molecular cloning of mouse and bovine chondromodulin-II cDNAs and the growth-promoting actions of bovine recombinant protein." Shukunami C., Kondo J., Wakai H., Takahashi K., Inoue H., Kamizono A., Hiraki Y. J. Biochem. 125:436-442(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O88803

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A