null

Recombinant Human Leukocyte cell-derived chemotaxin 1 (LECT1), partial | CSB-EP012854HU1

(No reviews yet) Write a Review
SKU:
CSB-EP012854HU1
Availability:
13 - 23 Working Days
  • Recombinant Human Leukocyte cell-derived chemotaxin 1 (LECT1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00
Frequently bought together:

Description

Recombinant Human Leukocyte cell-derived chemotaxin 1 (LECT1), partial | CSB-EP012854HU1 | Cusabio

Alternative Name(s): Cleaved into the following 2 chains: Chondrosurfactant protein Short name: CH-SP Chondromodulin-1 Alternative name(s): Chondromodulin-I Short name: ChM-I

Gene Names: LECT1

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: EVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 215-334aa

Sequence Info: Partial

MW: 29.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization.

Reference: "Expression of cartilage-specific functional matrix chondromodulin-I mRNA in rabbit growth plate chondrocytes and its responsiveness to growth stimuli in vitro."Shukunami C., Hiraki Y.Biochem. Biophys. Res. Commun. 249:885-890(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization.

Involvement in disease:

Subcellular Location: Chondromodulin-1: Secreted, extracellular space, extracellular matrix

Protein Families: Chondromodulin-1 family

Tissue Specificity: Detected in cartilage and cardiac valves (at protein level). Detected in the laminae fibrosa, spongiosa and ventricularis layers of normal cardiac valves (at protein level). Expression is decreased cardiac valves of patients with valvular heart disease (at protein level). Weakly expressed in chondrosarcoma.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O75829

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose