Recombinant Mouse Leucine-rich repeat LGI family member 3 (Lgi3) | CSB-EP812997MO

(No reviews yet) Write a Review
SKU:
CSB-EP812997MO
Availability:
3 - 7 Working Days
£281.60 - £1,361.60

Description

Recombinant Mouse Leucine-rich repeat LGI family member 3 (Lgi3) | CSB-EP812997MO | Cusabio

Alternative Name(s): Leubrin (Leucine-rich glioma-inactivated protein 3)

Gene Names: Lgi3

Research Areas: Neuroscience

Organism: Mus musculus(Mouse)

AA Sequence: KRPPKTPPCPPSCSCTRDTAFCVDSKSVPKNLPSEVISLTLVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFIGLSHLQYLFIENNDIWALSKFTFRGLKSLTHLSLANNNLQTLPRDIFRPLDILSDLDLRGNALNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPLREFDCITTDFVLYQTLSFPAVSAEPFLYSSDLYLALAQPGASACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDGQLYVVVAQLFGGSYIYHWDPNTTRFTKLQDIDPQRVRKPNDLEAFRIDGDWFFAVADSSKAGATSLYRWHQNGFYSHQALHAWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRSQKQFVAQGEVTQVPDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGHRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHVVVDLSA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 31-548aa

Sequence Info: Full Length of Mature Protein

MW: 62.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May participate in the regulation of neuronal exocytosis.

Reference: "Leucine-rich glioma inactivated 3 associates with syntaxin 1." Park W.-J., Lee S.E., Kwon N.S., Baek K.J., Kim D.-S., Yun H.-Y. Neurosci. Lett. 444:240-244(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8K406

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose