Recombinant Mouse Killer cell lectin-like receptor 3 (Klra3), partial | CSB-EP720664MO

Recombinant Mouse Killer cell lectin-like receptor 3 (Klra3), partial | CSB-EP720664MO | Cusabio

Alternative Name(s): 5E6 Lymphocyte antigen 49c Short name: Ly-49c Nk2.1 T-cell surface glycoprotein Ly-49C Ly-49c, Ly49C

Gene Names: Klra3

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 70-266aa

Sequence Info: Partial

MW: 27.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Receptor on natural killer (NK) cells for class I MHC.

Reference: "Ly-49 multigene family. New members of a superfamily of type II membrane proteins with lectin-like domains." Wong S., Freeman J.D., Kelleher C., Mager D., Takei F. J. Immunol. 147:1417-1423(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor on natural killer (NK) cells for class I MHC.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type II membrane protein

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q64329

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A