Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22) | CSB-EP325391MO

(No reviews yet) Write a Review
SKU:
CSB-EP325391MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22) | CSB-EP325391MO | Cusabio

Alternative Name(s): Beta-NGF-endopeptidase;Epidermal growth factor-binding protein type A ;EGF-BP AGlandular kallikrein K22 ;mGK-22Nerve growth factor beta chain endopeptidaseTissue kallikrein 22

Gene Names: Klk1b22

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 25-259aa

Sequence Info: Full Length of Mature Protein

MW: 41.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Reference: Mouse glandular kallikrein genes. Structure and partial sequence analysis of the kallikrein gene locus.Evans B.A., Drinkwater C.C., Richards R.I.J. Biol. Chem. 262:8027-8034(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Involvement in disease:

Subcellular Location:

Protein Families: Peptidase S1 family, Kallikrein subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P15948

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose