Recombinant Mouse Interleukin-18 (Il18) | CSB-YP011608MOe1

Recombinant Mouse Interleukin-18 (Il18) | CSB-YP011608MOe1 | Cusabio

Alternative Name(s): Interferon gamma-inducing factor

Gene Names: Il18

Research Areas: Immunology

Organism: Mus musculus (Mouse)

AA Sequence: MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Source: Yeast

Tag Info: Tag-Free

Expression Region: 1-192aa

Sequence Info: Full Length

MW: 22.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Reference: "Active stage of autoimmune diabetes is associated with the expression of a novel cytokine, IGIF, which is located near Idd2." Rothe H., Jenkins N.A., Copeland N.G., Kolb H. J. Clin. Invest. 99:469-474(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: IL-1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P70380

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A