Recombinant Mouse Interferon alpha-7 (Ifna7) | CSB-EP011043MOe1

(No reviews yet) Write a Review
SKU:
CSB-EP011043MOe1
Availability:
13 - 23 Working Days
$552.00 - $2,172.00

Description

Recombinant Mouse Interferon alpha-7 (Ifna7) | CSB-EP011043MOe1 | Cusabio

Alternative Name(s): IFN-alpha-7 (Ifa7)

Gene Names: Ifna7

Research Areas: Immunology

Organism: Mus musculus (Mouse)

AA Sequence: CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQAKVDAQQIQEAQAIPVLSELTQQILNIFTSKDSSAAWNATLLDSVCNDLHQQLNDLQGCLMQEVGVQELSLTQEDSLLAVRKYFHRITVFLREKKHSPCAWEVVRAEIWRALSSSANLLARLSEKKE

Source: E.coli

Tag Info: Tag-Free

Expression Region: 24-190aa

Sequence Info: Full Length of Mature Protein

MW: 19.0 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Reference: "Sequence and expression of a novel murine interferon alpha gene -- homology with enhancer elements in the regulatory region of the gene." Dion M., Vodjdani G., Doly J. Biochem. Biophys. Res. Commun. 138:826-834(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P06799

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose