Recombinant Mouse Intercellular adhesion molecule 4 (Icam4), partial | CSB-EP880644MO

Recombinant Mouse Intercellular adhesion molecule 4 (Icam4), partial | CSB-EP880644MO | Cusabio

Alternative Name(s): CD_antigen: CD242

Gene Names: Icam4

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: QQEWMQSPPAPSVTSAPFWVRLNPELEAVPPGGSAWLNCSHNCPLPVHSSLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGETREATARITAYKRPRSVILEPPVLVGHKYTLRCYVTHVFPVGFLVVSLRRGGRVIYHESLERFTGSDLANVTLTYVMRAGLNDLWQPLTCHARLNLDGLVVRSSSAPVMLTVLALSPAS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 23-231aa

Sequence Info: Extracellular Domain

MW: 39.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity). Isoform 2 may modulate binding of membrane-associated ICAM4.

Reference: "Novel secreted isoform of adhesion molecule ICAM-4: potential regulator of membrane-associated ICAM-4 interactions."Lee G., Spring F.A., Parsons S.F., Mankelow T.J., Peters L.L., Koury M.J., Mohandas N., Anstee D.J., Chasis J.A.Blood 101:1790-1797(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity). Isoform 2 may modulate binding of membrane-associated ICAM4.

Involvement in disease:

Subcellular Location: Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted

Protein Families: Immunoglobulin superfamily, ICAM family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9ERM2

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A