Recombinant Mouse Integrin alpha-L (Itgal), partial | CSB-YP011875MO

(No reviews yet) Write a Review
SKU:
CSB-YP011875MO
Availability:
25 - 35 Working Days
  • Recombinant Mouse Integrin alpha-L (Itgal), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £908.00

Description

Recombinant Mouse Integrin alpha-L (Itgal), partial | CSB-YP011875MO | Cusabio

Alternative Name(s): CD11 antigen-like family member ALeukocyte adhesion glycoprotein LFA-1 alpha chain ;LFA-1ALeukocyte function-associated molecule 1 alpha chain;Lymphocyte antigen 15 ;Ly-15; CD11a

Gene Names: Itgal

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 153-325aa

Sequence Info: Partial

MW: 21.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Mice expressing a null mutation of the alpha-L subunit gene donstrate impaired tumor rejection and impaired leukocytes recruitment.

Reference: Cloning of the murine lymphocyte function-associated molecule-1 alpha-subunit and its expression in COS cells.Kaufmann Y., Tseng E., Springer T.A.J. Immunol. 147:369-374(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families: Integrin alpha chain family

Tissue Specificity: Leukocytes.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P24063

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose