Recombinant Mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog (Mcl1), partial | CSB-EP013588MO

Recombinant Mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog (Mcl1), partial | CSB-EP013588MO | Cusabio

Alternative Name(s): Bcl-2-related protein EAT/mcl1

Gene Names: Mcl1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGG

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-308aa

Sequence Info: Partial

MW: 48.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 2 has antiapoptotic activity.

Reference: MCL-1V, a novel mouse antiapoptotic MCL-1 variant, generated by RNA splicing at a non-canonical splicing pair.Kojima S., Hyakutake A., Koshikawa N., Nakagawara A., Takenaga K.Biochem. Biophys. Res. Commun. 391:492-497(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 2 has antiapoptotic activity.

Involvement in disease:

Subcellular Location: Membrane, Single-pass membrane protein, Cytoplasm, Mitochondrion, Nucleus, nucleoplasm

Protein Families: Bcl-2 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P97287

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A