Recombinant Mouse Hyaluronan and proteoglycan link protein 1 (Hapln1) | CSB-MP010130MO

(No reviews yet) Write a Review
SKU:
CSB-MP010130MO
Availability:
18 - 28 Working Days
  • Recombinant Mouse Hyaluronan and proteoglycan link protein 1 (Hapln1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£308.80 - £720.00

Description

Recombinant Mouse Hyaluronan and proteoglycan link protein 1 (Hapln1) | CSB-MP010130MO | Cusabio

Alternative Name(s): Cartilage-linking protein 1 Short name: Cartilage-link protein Proteoglycan link protein

Gene Names: Hapln1

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: ISVCWADHHLSDSYTPPDQDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLREVDVFVSMGYHKKTYGGYQGRVFLKGGSDNDASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALELQGVVFPYFPRLGRYNLNFHEARQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKLLGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 10-356aa

Sequence Info: Full Length of Mature Protein

MW: 43.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.

Reference: "Characterization and chromosomal location of the mouse link protein gene (Crtl1)."Deak F., Mates L., Krysan K., Liu Z., Szabo P.E., Mann J.R., Beier D.R., Kiss I.Cytogenet. Cell Genet. 87:75-79(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.

Involvement in disease:

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: HAPLN family

Tissue Specificity: Ubiquitously expressed.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9QUP5

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose