Cusabio Mouse Recombinants
Recombinant Mouse H-2 class I histocompatibility antigen, K-D alpha chain (H2-K1), partial | CSB-EP355780MO
- SKU:
- CSB-EP355780MO
- Availability:
- 13 - 23 Working Days
Description
Recombinant Mouse H-2 class I histocompatibility antigen, K-D alpha chain (H2-K1), partial | CSB-EP355780MO | Cusabio
Alternative Name(s): H2-K1; H2-K; H-2 class I histocompatibility antigen; K-D alpha chain; H-2K(D)
Gene Names: H2-K1
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKLPPSTVSNT
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 22-305aa
Sequence Info: Extracellular Domain
MW: 60 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Involved in the presentation of foreign antigens to the immune syst.
Reference: The phagosomal proteome in interferon-gamma-activated macrophages.Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.Immunity 30:143-154(2009)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Involved in the presentation of foreign antigens to the immune system.
Involvement in disease:
Subcellular Location: Membrane, Single-pass type I membrane protein
Protein Families: MHC class I family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P01902
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A