Recombinant Mouse Growth-regulated alpha protein (Cxcl1), partial | CSB-RP092174m

(No reviews yet) Write a Review
SKU:
CSB-RP092174m
Availability:
13 - 23 Working Days
  • Recombinant Mouse Growth-regulated alpha protein (Cxcl1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Mouse Growth-regulated alpha protein (Cxcl1), partial | CSB-RP092174m | Cusabio

Alternative Name(s): C-X-C motif chemokine 1;Platelet-derived growth factor-inducible protein KCSecretory protein N51

Gene Names: Cxcl1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 29-96aa

Sequence Info: Partial

MW: 11.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has chotactic activity for neutrophils. Contributes to neutrophil activation during inflammation . Hatoregulatory chokine, which, in vitro, suppresses hatopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hatopoietic activity.1 Publication

Reference: The platelet-derived growth factor-inducible KC gene encodes a secretory protein related to platelet alpha-granule proteins.Oquendo P., Alberta J., Wen D., Graycar J.L., Derynck R., Stiles C.D.J. Biol. Chem. 264:4133-4137(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation (By similarity). Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hematopoietic activity.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine alpha (chemokine CxC) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P12850

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose