Recombinant Mouse Group XIIA secretory phospholipase A2 (Pla2g12a) | CSB-EP863638MO

Recombinant Mouse Group XIIA secretory phospholipase A2 (Pla2g12a) | CSB-EP863638MO | Cusabio

Alternative Name(s): Phosphatidylcholine 2-acylhydrolase 12A

Gene Names: PLA2G12A

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: QEQDQTTDWRATLKTIRNGIHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPVPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLSQNVQACETTVELLFDSVIHLGCKPYLDSQRAACWCRYEEKTDL

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 26-192aa

Sequence Info: Full Length of Mature Protein

MW: 34.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine .

Reference: A novel group of phospholipase A2s preferentially expressed in type 2 helper T cells.Ho I.C., Arm J.P., Bingham C.O. III, Choi A., Austen K.F., Glimcher L.H.J. Biol. Chem. 276:18321-18326(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine (By similarity).

Involvement in disease:

Subcellular Location: Secreted, Cytoplasm

Protein Families: Phospholipase A2 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9EPR2

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A