Recombinant Mouse Granzyme A (Gzma) | CSB-EP010081MO

(No reviews yet) Write a Review
SKU:
CSB-EP010081MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Granzyme A (Gzma)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse Granzyme A (Gzma) | CSB-EP010081MO | Cusabio

Alternative Name(s): Autocrine thymic lymphoma granzyme-like serine protease CTLA-3 Fragmentin-1 T cell-specific serine protease 1

Gene Names: Gzma

Research Areas: Cell Biology

Organism: Mus musculus (Mouse)

AA Sequence: IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

Expression Region: 29-260aa

Sequence Info: Full Length of Mature Protein

MW: 39.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA

Reference: "Genomic organization of the mouse granzyme A gene. Two mRNAs encode the same mature granzyme A with different leader peptides." Hershberger R.J., Gershenfeld H.K., Weissman I.L., Su L. J. Biol. Chem. 267:25488-25493(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA (By similarity).

Involvement in disease:

Subcellular Location: Secreted, Cytoplasmic granule

Protein Families: Peptidase S1 family, Granzyme subfamily

Tissue Specificity: Found in cytotoxic lymphocytes and in normal lymphoid tissues such as thymus and spleen.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P11032

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose