Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2) (Active) | CSB-AP003651MO

Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2) (Active) | CSB-AP003651MO | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : Granulocyte-Macrophage Colony-Stimulating Factor; GM-CSF; Colony-Stimulating Factor; CSF;Molgramostin; Sargramostim; CSF2; GMCSF

Gene Names: Csf2

Research Areas: Immunology

Species: Mus musculus (Mouse)

Source: Mammalian cell

Tag Info: C-terminal 6xHis-tagged

Expression Region: 18-141aa

Sequence Info: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Biological Activity: The ED50 as determined in a cell proliferation assay using PDC-P1 cells is less than 100 pg/ml.

MW: 15.1 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factorthat can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by anumber of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cellsand fibroblasts) in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophageprogenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. Onmature hematopoietic, monocytes/ macrophages and eosinophils. GM-CSF has a functional role on nonhematopoitic cells. It can induce human endothelial cells to migrate and proliferate. Additionally, GM-CSF canalso stimulate the proliferation of a number of tumor cell lines, including osteogenic sarcoma, carcinoma andadenocarcinoma cell lines.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: GM-CSF family

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01587

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A