Recombinant Mouse Glutathione peroxidase 7 (Gpx7) | CSB-EP009872MO

(No reviews yet) Write a Review
SKU:
CSB-EP009872MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Glutathione peroxidase 7 (Gpx7)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Mouse Glutathione peroxidase 7 (Gpx7) | CSB-EP009872MO | Cusabio

Alternative Name(s): /

Gene Names: Gpx7

Research Areas: Cell Biology

Organism: Mus musculus (Mouse)

AA Sequence: QSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENFARRTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKPRITEQVMKLILRKREDL

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal MYC-tagged

Expression Region: 19-186aa

Sequence Info: Full Length of Mature Protein

MW: 26.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks (By similarity).

Reference: "Protein disulfide isomerase and glutathione are alternative substrates in the one Cys catalytic cycle of glutathione peroxidase 7." Bosello-Travain V., Conrad M., Cozza G., Negro A., Quartesan S., Rossetto M., Roveri A., Toppo S., Ursini F., Zaccarin M., Maiorino M. Biochim. Biophys. Acta 1830:3846-3857(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99LJ6

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose