Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial | CSB-EP009514MO1

Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial | CSB-EP009514MO1 | Cusabio

Alternative Name(s): Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R

Gene Names: Glp1r

Research Areas: Neuroscience

Organism: Mus musculus (Mouse)

AA Sequence: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-145aa

Sequence Info: Partial

MW: 30.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Reference: "Mouse pancreatic beta-cells exhibit preserved glucose competence after disruption of the glucagon-like peptide-1 receptor gene."Flamez D., van Breusegem A., Scrocchi L.A., Quartier E., Pipeleers D., Drucker D.J., Schuit F.Diabetes 47:646-652(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: G-protein coupled receptor for glucagon-like peptide 1 (GLP-1)

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: G-protein coupled receptor 2 family

Tissue Specificity: Detected in pancreatic islets (at protein level). Detected in pancreatic islets and lungs.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O35659

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A