Recombinant Mouse Fibroblast growth factor 17 (Fgf17) (Active) | CSB-AP004121MO

Recombinant Mouse Fibroblast growth factor 17 (Fgf17) (Active) | CSB-AP004121MO | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : Fibroblast growth factor 17; FGF-17;fgf17

Gene Names: Fgf17

Research Areas: Signal Transduction

Species: Mus musculus (Mouse)

Source: E.coli

Tag Info: C-terminal 6xHis-tagged

Expression Region: 23-216aa

Sequence Info: TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT

Biological Activity: The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 3 ug/ml.

MW: 23.7 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: FGF-17 is a member of the fibroblast growth factor (FGF) family. FGFs share 30 70% amino acid (aa) identity in a conserved, approximately 120 amino acid core domain. FGFs play multiple roles in biological functions, including angiogenesis, mitogenesis, cell differentiation and wound repair. FGF17 plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. It is also expressed in hindgut, parts of the developing skeleton, tail bud, major arteries, and heart. In many of these areas, it is expressed along with FGF-8, but slightly later. It is required for normal brain development.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Heparin-binding growth factors family

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P63075

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A