Recombinant Mouse Fibroblast growth factor 1 (Fgf1) | CSB-EP008615MO

(No reviews yet) Write a Review
SKU:
CSB-EP008615MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Fibroblast growth factor 1 (Fgf1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Mouse Fibroblast growth factor 1 (Fgf1) | CSB-EP008615MO | Cusabio

Alternative Name(s): Acidic fibroblast growth factor ;aFGFHeparin-binding growth factor 1 ;HBGF-1

Gene Names: Fgf1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 16-155aa

Sequence Info: Full Length of Mature Protein

MW: 19.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro .

Reference: Isolation of cDNAs encoding four mouse FGF family members and characterization of their expression patterns during embryogenesis.Hebert J.M., Basilico C., Goldfarb M., Haub O., Martin G.R.Dev. Biol. 138:454-463(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV

Involvement in disease:

Subcellular Location: Secreted, Cytoplasm, Cytoplasm, cell cortex, Cytoplasm, cytosol, Nucleus

Protein Families: Heparin-binding growth factors family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P61148

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose