Recombinant Mouse F-box/WD repeat-containing protein 10 (Fbxw10), partial | CSB-EP725549MO

(No reviews yet) Write a Review
SKU:
CSB-EP725549MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse F-box/WD repeat-containing protein 10 (Fbxw10), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Mouse F-box/WD repeat-containing protein 10 (Fbxw10), partial | CSB-EP725549MO | Cusabio

Alternative Name(s): F-box and WD-40 domain-containing protein 10

Gene Names: Fbxw10

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: VKWQYSSDKNKVKKSKDKEEEREETSLGDEHSRSTIQGHSLKDSVSSKQEFSKSRVHLKQTKNLSSDDMETPVGEVSHPLQKLWKVPMTPDRFLLTISALQQAHNSEEFAYPHRPRPQVIDAWGPSIPYPRKVLSLKGKSVQHAVDQLRSSNLPTGVRQTNIPLEIQKLQPNLKKSLHSPRVQATVPQPSLIRPKVSDSLRGDEHLTSSIDGTMRRAGPLTSMQVIKPNRMLAPRGGTATLSPKKERPRFYTTLDPLRMNTGFMLMTVKEEKEFAEAKMKEYEASVSTKEVDPGKASKAAWIRKIKGLPIDNFMKEGKTAAPELGQNVFI

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 701-1030aa

Sequence Info: Partial

MW: 53.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Probable substrate-recognition component of a SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Overexpression is leading to degradation of CBX5 and CBX1 (By similarity).

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Probable substrate-recognition component of a SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Overexpression is leading to degradation of CBX5 and CBX1 (By similarity).

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q5SUS0

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose