Recombinant Mouse Excitatory amino acid transporter 2 (Slc1a2), partial | CSB-EP021433MO

Recombinant Mouse Excitatory amino acid transporter 2 (Slc1a2), partial | CSB-EP021433MO | Cusabio

Alternative Name(s): GLT-1Sodium-dependent glutamate/aspartate transporter 2Solute carrier family 1 member 2

Gene Names: Slc1a2

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 143-238aa

Sequence Info: Partial

MW: 37.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly roving released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.

Reference: Palmitoylation and function of glial glutamate transporter-1 is reduced in the YAC128 mouse model of Huntington disease.Huang K., Kang M.H., Askew C., Kang R., Sanders S.S., Wan J., Davis N.G., Hayden M.R.Neurobiol. Dis. 40:207-215(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A2 subfamily

Tissue Specificity: Detected in brain (PubMed:9180080). Detected in embryonic forebrain, especially in globus pallidus, perirhinal cortex, lateral hypothalamus, hippocampus, and on fimbria and axonal pathways connecting the neocortex, basal ganglia and thalamus (at protein level) (PubMed:16880397). Isoform GLT1 is expressed in the brain (PubMed:7698742, PubMed:7557442, PubMed:9373176, PubMed:9180080). Isoforms GLT-1A and GLT-1B are expressed in the liver (PubMed:9373176).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P43006

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A