Cusabio Mouse Recombinants
Recombinant Mouse Erythropoietin receptor (Epor), partial | CSB-EP007744MO1
- SKU:
- CSB-EP007744MO1
- Availability:
- 13 - 23 Working Days
Description
Recombinant Mouse Erythropoietin receptor (Epor), partial | CSB-EP007744MO1 | Cusabio
Alternative Name(s): Erythropoietin receptor(EPO-R)
Gene Names: Epor
Research Areas: Cardiovascular
Organism: Mus musculus (Mouse)
AA Sequence: APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP
Source: E.coli
Tag Info: C-terminal 10xHis-tagged
Expression Region: 25-249aa
Sequence Info: Partial
MW: 26.2 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate the LYN tyrosine kinase.
Reference: "Saturation mutagenesis of the WSXWS motif of the erythropoietin receptor." Hilton D.J., Watowich S.S., Katz L., Lodish H.F. J. Biol. Chem. 271:4699-4708(1996)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P14753
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A