Recombinant Mouse Enteropeptidase (Tmprss15), partial | CSB-EP018824MO

Recombinant Mouse Enteropeptidase (Tmprss15), partial | CSB-EP018824MO | Cusabio

Alternative Name(s): Enterokinase Serine protease 7 Transmembrane protease serine 15 Cleaved into the following 2 chains: Enteropeptidase non-catalytic heavy chain Enteropeptidase catalytic light chain

Gene Names: Tmprss15

Research Areas: Cell Biology

Organism: Mus musculus (Mouse)

AA Sequence: IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 830-1069aa

Sequence Info: Partial

MW: 43 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases

Reference: "The amino-terminal sequence of the catalytic subunit of bovine enterokinase."Light A., Janska H.J. Protein Chem. 10:475-480(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases (By similarity).

Involvement in disease:

Subcellular Location: Membrane, Single-pass type II membrane protein

Protein Families: Peptidase S1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P97435

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A