Recombinant Mouse Endothelin-converting enzyme-like 1 (Ecel1), partial | CSB-EP878117MO

Recombinant Mouse Endothelin-converting enzyme-like 1 (Ecel1), partial | CSB-EP878117MO | Cusabio

Alternative Name(s): Damage-induced neuronal endopeptidase Xce protein Dine, Xce

Gene Names: Ecel1

Research Areas: Neuroscience

Organism: Mus musculus (Mouse)

AA Sequence: MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-61aa

Sequence Info: Partial

MW: 13.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides.

Reference: "Neonatal lethality in mice deficient in XCE, a novel member of the endothelin-converting enzyme and neutral endopeptidase family." Schweizer A., Valdenaire O., Koster A., Lang Y., Schmitt G., Lenz B., Bluethmann H., Rohrer J. J. Biol. Chem. 274:20450-20456(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type II membrane protein

Protein Families: Peptidase M13 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9JMI0

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A